PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa009138
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family GRF
Protein Properties Length: 328aa    MW: 37423.5 Da    PI: 8.3368
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-1548PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.94.9e-2590133144
        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e
  Lsa009138  90 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE 133
                79***************************************998 PP

2QLQ57.25.2e-202155236
        QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
               +FTa+Q+q+L++Q+l+yKy+++++P+Pp+Ll  i+
  Lsa009138 21 PFTASQWQELEHQALVYKYMISGMPIPPDLLYTIK 55
               8*****************************97776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.8E-112056IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.4E-152154IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.0742156IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.32590134IPR014977WRC domain
PfamPF088792.9E-2191133IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MSTEGGGGGG SLRNNNGGRF PFTASQWQEL EHQALVYKYM ISGMPIPPDL LYTIKKSLES  60
STKLLLHHHQ PPHPSIGWNC FQMGFGRKID PEPGRCRRTD GKKWRCSKEA YPDSKYCERH  120
MHRGRNRSRK PVEVNLSTHP NSKTPPTPTP IPMISSKSPN YPSPNSHPIS SYSRSMGSNV  180
LSSQDHFLLE SNPYRKSYVG MKEEIDEHSF FSESSGTIKS SDPWQLEPLA MNNPNSSLAH  240
LKQQTSFSDY HQNGYLQYPH EQHQDQGSYY NHQIGLKIAR KDEPQKVMHH FFDEWPPNDE  300
NNQDSSTTQL SISIPSSAHD FFLTHNDK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767378.11e-99PREDICTED: growth-regulating factor 1-like
RefseqXP_016449440.11e-99PREDICTED: growth-regulating factor 1-like isoform X2
TrEMBLA0A103XNJ91e-144A0A103XNJ9_CYNCS; Glutamine-Leucine-Glutamine, QLQ
STRINGPOPTR_0018s07140.16e-94(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-51growth-regulating factor 5